Dark circles are caused by various factors, including genetics, thin skin under the eyes, hyperpigmentation around the eyes, and even lifestyle choices, says Dr
Product Attributes CAS # : 2103905-91-3 Molecular Formula : C201H325N65O67 Sequence (AA) : (D-Arg)9-LTLRKEPASEIAQSILEAYSQNGWANRRSAGGKRPPPRRRQRRKKRG Molecular Weight : ~4598 g/mol PubChem CID : N/A (peptide not indexed) Half-Life : ~2-4 hours Synonyms : Proxofim, FOXO4-D-Retro-Inverso, FOXO4-p53 Interfering Peptide Type : Synthetic D-retro-inverso peptide (senolytic research compound) Research Focus : Longevity & Senescence, Cellular Repair Scientific References Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging Animal | In vitro FOXO4-DRI peptide selectively induces apoptosis in senescent cells Animal | In vitro Senolytics: Eliminating Senescent Cells and Alleviating Intervertebral Disc Degeneration Animal | In vitro Cellular senescence: Defining a path forward Observational | Animal | In vitro The role of senescent cells in ageing Animal | In vitro FOXO4 peptide disrupts FOXO4-p53 interaction to target senescent cells Animal | In vitro Senolytic therapy alleviates age-associated bone loss in mice Animal | In vitro Therapeutic interventions for aging: the case of cellular senescence Observational | Animal | In vitro Included In The Box Every product arrives in a premium, custom-designed PEPTIDE.Power box , engineered for convenience, hygiene, and safe storage in your refrigerator
Triggers, protectors, and predictors in episodic migraine
The presence of these enzymes is important because they regulate carnitine production, an essential amino acid that helps cells produce energy and are also responsible for regulating metabolism
